PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D10G0194
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 315aa    MW: 35628.9 Da    PI: 6.0376
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D10G0194genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.61.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d+++ +G g+W+t ++  g+ R++k+c++rw +yl
      Gh_D10G0194 14 KGPWTPEEDQKLIDYIQTHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding53.74.7e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
      Gh_D10G0194  67 RGRFSFEEEEAIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-26564IPR009057Homeodomain-like
PROSITE profilePS5129418.197961IPR017930Myb domain
SuperFamilySSF466897.86E-3211108IPR009057Homeodomain-like
SMARTSM007171.5E-131363IPR001005SANT/Myb domain
PfamPF002491.2E-161461IPR001005SANT/Myb domain
CDDcd001679.61E-131661No hitNo description
PROSITE profilePS5129425.44662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2665116IPR009057Homeodomain-like
SMARTSM007172.2E-1666114IPR001005SANT/Myb domain
PfamPF002492.7E-1567111IPR001005SANT/Myb domain
CDDcd001671.48E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRTPCCDKN GLKKGPWTPE EDQKLIDYIQ THGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEEAIIQ LHSVLGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDLSSILG CCSFYNQSQM NMSTRLLGGG GGVQPLVNPE ILRLATSIMS  180
SPQRENQNPD ILFHENQYQQ PPLMQNTNVA EPVMNNNPNV IIDQFPFNGC FTDWQNNANA  240
VLPYLTEDNY VPVPSNCYGG GNGEPSFRTP SSSSPTPLNS NNSTYINSSS TEDESYSSDI  300
LKFEIPDFLD VNEFM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29121165108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6166170.0JX616617.1 Gossypium hirsutum clone NBRI_GE61408 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012452943.10.0PREDICTED: transcription factor MYB39-like
TrEMBLA0A0D2RFR30.0A0A0D2RFR3_G
STRINGGLYMA15G07230.11e-123(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-108MYB-like 102